PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.042160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 195aa    MW: 22024.3 Da    PI: 5.0215
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.042160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB168.21e-5254150197
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqd+++P+anv+rimk++lP++akis+d+ket+qecvse+isf+tsea+++cqre+rkt++++d+lwa+++lGf+dy+epl+v+l++yre e+
  Cucsa.042160.1  54 VREQDQYMPMANVIRIMKRILPSHAKISDDTKETIQECVSEYISFITSEANERCQREQRKTVTAEDVLWAMGKLGFDDYIEPLTVFLNRYRESES 148
                     69*******************************************************************************************99 PP

           NF-YB  96 ek 97 
                     ++
  Cucsa.042160.1 149 DR 150
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-4848150IPR009072Histone-fold
SuperFamilySSF471134.35E-3657150IPR009072Histone-fold
PfamPF008086.2E-2560124IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-1688106No hitNo description
PROSITE patternPS00685091107IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.0E-16107125No hitNo description
PRINTSPR006152.0E-16126144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MMLTPNNQTS INNNPNTNHH LSDGGTSIGN SSATSPLSVA ATANNNEQNQ QCLVREQDQY  60
MPMANVIRIM KRILPSHAKI SDDTKETIQE CVSEYISFIT SEANERCQRE QRKTVTAEDV  120
LWAMGKLGFD DYIEPLTVFL NRYRESESDR IRTEPMWRRN VDYGPQVGMI SPYGQGFQIG  180
HVPAGMFDAM GGYYX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-3955145393NF-YB
4awl_B4e-3955145494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-3955145494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449191.11e-132PREDICTED: nuclear transcription factor Y subunit B-9
SwissprotQ9SFD85e-63NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A0A0L2U11e-130A0A0A0L2U1_CUCSA; Uncharacterized protein
STRINGVIT_00s0956g00020.t019e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.14e-62NF-YB family protein